Sale!

wereproudoftreatingeachclientasiftheywereamemberofthefamilyfindingthevitakraftguineapigcrunchstickswildberryflavoredglaze2countvitakraftforpeopleisourlove0.jpg

Vitakraft Guinea Pig Crunch Sticks Wild Berry Flavored Glaze – 2 count Vitakraft

$ 5,65

SKU: mode_9101657866559 Category: Small Pet Supplies Tags: 5-10, Small Pet Guinea Pig Treats, vitakraft

Description
shopping

Vitakraft Triple Baked Crunch Sticks Guinea Pig Treats are made with real wild berries, sweet honey and delicious yogurt to give your little furry friend the chewing sensation and delicious natural flavors he craves!

Triple baked treats for crunchiness and taste
Natural wood stick inside for long-lasting chewing fun
Clip holder included

Each treat is coated with tasty wild berries, honey and yogurt, then triple baked around a natural wooden stick for optimum crunchiness and taste! The included clip holder makes hanging the stick in your pets cage easy.

Ingredients: Wheat, Wheat Flour, Yellow Millet, Corn, Ground Grain Sorghum, Heat-processed Oats, Corn Starch, Oats, Oat Groats, Buckwheat, Dried Figs, Dried Apricot, Peanuts, Calcium Propionate (a Preservative), Honey, Lecithin, Sugar, Wheat Starch, Color Added (Yellow 5, Yellow 6), Vitamin A Supplement, Vitamin D3 Supplement, Vitamin E Supplement, L-Ascorbyl-2-Polyphosphate, Riboflavin Supplement, Pyridoxine Hydrochloride, Vitamin B12 Supplement, Niacin Supplement, d-Calcium Pantothenate, Biotin, Choline Chloride.

Guaranteed Analysis:

Crude Protein (min) – 10.0%

Crude Fat (min) – 3.0%

Crude Fiber (max) – 4.5%

Moisture (max) – 14.0%

Vit. A (min) – 7,898 IU/kg

Vit. D3 (min) – 780 IU/kg

Vit. E (min) – 70 IU/kg

Prompt Delivery and professional packaging

Thanks to our longstanding association with UPS FedEx DHL as well as other leading international carriers, we are able to offer a variety shipping options. Our warehouse personnel are well educated and will package your goods in accordance with our exact and precise specifications. Your items will go through an exhaustive examination before they will be securely packaged before being sent out. We ship to thousands customers every day from all over the world. This is a testament to our determination to become the largest online retailer globally. Both Europe and the USA have distribution and warehouse centres.

Note: Orders that contain more than one item will be assigned a processing date in accordance with the item.

Prior to shipping, we inspect the ordered items carefully before shipping. Today, the majority orders will be shipped within 48 hours. The delivery time is between 3-7 working days.

Returns

We do not manage the stock at our warehouse or factory. The actual inventory may fluctuate at any time. Please be aware it's possible your order could be unable to fill when you have placed the order.

Our policy is valid for 30 days. If you don't receive the product within 30 days, we're unable to offer the option of a refund or exchange.

In order to be eligible for a refund, your product must be unopened and in the same condition as you received it in. It should also be in its original packaging.

Vitakraft Guinea Pig Crunch Sticks Wild Berry Flavored Glaze – 2 count Vitakraft

Related products

Login