Sale!

purchasethelatestprettypetsbirdspeciesspecifichienergymacaw3lbprettypetsproductsataffordableprices0.jpg

purchasethelatestprettypetsbirdspeciesspecifichienergymacaw3lbprettypetsproductsataffordableprices1.jpg

Pretty Pets Bird Species Specific Hi Energy Macaw – 3 lb Pretty Pets

$ 15,22

SKU: mode_9101619691839 Category: Bird Supplies Tags: 25-30, Bird Parrot Food, pretty-pets

Description
shopping

Pretty Bird Species Specific Hi Energy Macaw food is designed for species that require high fat levels such as Macaws, Golden Conures, and Black Palm Cockatoos. This food contains all the proper vitamins and minerals to give these birds a complete and balanced diet.

High fat content for high energy birds
Ideal for Macaws, Golden Conures and Black Palm Cockatoos
16% protein and 10% fat

Guaranteed Analysis: Crude Protein (min) 16%, Crude Fat/Oil (min) 10%, Crude Fiber (max) 3%, Moisture (max) 10%, Ash (max) 5%, Vitamin A (min) 12,000 IU/kg, Vitamin D3 (min) 700 IU/kg, Vitamin E (min) 300 IU/kg, Copper (min) 10 mg/kg

Ingredients: Ground Corn, Ground Wheat, Ground Oat Groats, Corn Gluten Meal, Soya Oil, Potato Protein, Calcium Carbonate, Dicalcium Phosphate, Choline Chloride, Artificial Flavors, Attapulgite Clay, DL-Methionine, L-Lysine, Magnesium Oxide, Betaine Anhydrous, L-Ascorbyl-2-Polyphosphate, Vitamin E Supplement, Silicon Dioxide, Manganous Oxide, Niacinamide, Mixed Tocopherols, Copper Sulfate, Yucca schidigera Plant Extract, Zinc Oxide, FD&C Red 40, FD&C Yellow 6, FD&C Yellow 5, FD&C Blue 1, d-Calcium Pantothenate, Sodium Selenite, Vitamin A Acetate, Riboflavin, Biotin, Pyridoxine Hydrochloride, Thiamine Mononitrate, Vitamin B12 Supplement, Folic Acid, Calcium Iodate, Vitamin D3 Supplement, Rosemary Extract

Prompt Delivery and professional packaging

Thanks to our longstanding association with UPS FedEx DHL as well as other leading international carriers, we are able to offer a variety shipping options. Our warehouse personnel are well educated and will package your goods in accordance with our exact and precise specifications. Your items will go through an exhaustive examination before they will be securely packaged before being sent out. We ship to thousands customers every day from all over the world. This is a testament to our determination to become the largest online retailer globally. Both Europe and the USA have distribution and warehouse centres.

Note: Orders that contain more than one item will be assigned a processing date in accordance with the item.

Prior to shipping, we inspect the ordered items carefully before shipping. Today, the majority orders will be shipped within 48 hours. The delivery time is between 3-7 working days.

Returns

We do not manage the stock at our warehouse or factory. The actual inventory may fluctuate at any time. Please be aware it's possible your order could be unable to fill when you have placed the order.

Our policy is valid for 30 days. If you don't receive the product within 30 days, we're unable to offer the option of a refund or exchange.

In order to be eligible for a refund, your product must be unopened and in the same condition as you received it in. It should also be in its original packaging.

Pretty Pets Bird Species Specific Hi Energy Macaw – 3 lb Pretty Pets

Related products

Login